Bacteria isdA protein
This Bacteria isdA protein spans the amino acid sequence from region 47-316aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Fur-regulated protein A Staphylococcal transferrin-binding protein A frpA, stbA
UniProt
Q6GA85
Expression Region
47-316aa
Tag
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Source
E.coli
Origin
Staphylococcus aureus (strain MSSA476)
Field of Research
Epigenetics, Non-Animal
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
35.1 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Full Length of Mature Protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
ATEATNATNNQSTQVSQATSQPINFQVQKDGSSEKSHMDDYMQHPGKVIKQNNKYYFQTVLNNASFWKEYKFYNANNQELATTVVNDNKKADTRTINVAVEPGYKSLTTKVHIVVPQINYNHRYTTHLEFEKAIPTLADAAKPNNVKPVQPKPAQPKTPTEQTKPVQPKVEKVKPTVTTTSKVEDNHSTKVVSTDTTKDQTKTQTAHTVKTAQTAQEQNKVQTPVKDVATAKSESNNQAVSDNKSQQTNKVTKHNETPKQASKAKELPKT
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
A02181-Fluoro550 100 µg/Vial
Anti-Aquaporin 3/Aqp3 Antibody Picoband® Fluoro550 Conjugated
Sign In for Pricing
View Details 
213541-01 20 µL
SPIN1 (Ovarian Cancer Related Protein, Spindlin-1, SPIN, OCR) discontinued
Sign In for Pricing
View Details 213541-02 100 µL
SPIN1 (Ovarian Cancer Related Protein, Spindlin-1, SPIN, OCR) discontinued
Sign In for Pricing
View Details orb2911766-01 20 µg
Recombinant Xenopus laevis Cytochrome b561 (cyb561)
Sign In for Pricing
View Details orb2911766-02 100 µg
Recombinant Xenopus laevis Cytochrome b561 (cyb561)
Sign In for Pricing
View Details