What is the catalog number for Virus mip protein?

The catalog number for Virus mip protein is orb604826.

What sizes are available for Virus mip protein?

Virus mip protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Virus mip protein come in?

Virus mip protein is available in 3 different pack sizes.

Is Virus mip protein in stock?

Virus mip protein is currently made to order / not held in immediate stock. Contact us for lead time.

Virus mip protein

This Virus mip protein spans the amino acid sequence from region 21-233aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Macrophage infectivity potentiator Peptidyl-prolyl cis-trans isomerase Short name, PPIase

UniProt

A5IGB8

Expression Region

21-233aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Legionella pneumophila (strain Corby)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ATDATSLATDKDKLSYSIGADLGKNFKNQGIDVNPEAMAKGMQDAMSGAQLALTEQQMKDVLNKFQKDLMAKRTAEFNKKADENKVKGEAFLTENKNKPGVVVLPSGLQYKVINAGNGVKPGKSDTVTVEYTGRLIDGTVFDSTEKTGKPATFQVSQVIPGWTEALQLMPAGSTWEIYVPSGLAYGPRSVGGPIGPNETLIFKIHLISVKKSS