Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Plant alr2278 protein

This Plant alr2278 protein spans the amino acid sequence from region 1-189aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

Q8YUQ7

Expression Region

1-189aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MYGLVNKAIQDMISKHHGEDTWEAIKQKAGLEDIDFFVGMEAYSDDVTYHLVGAASEVLGKPAEELLIAFGEYWVTYTSEEGYGELLASAGDSLPEFMENLDNLHARVGLSFPQLRPPAFECQHTSSKSMELHYQSTRCGLAPMVLGLLHGLGKRFQTKVEVTQTAFRETGEDHDIFSIKYEDSNLYDD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RGMB Protein Vector (Human) (pPM-C-HA)
PV115636 500 ng

RGMB Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
CAY10415
sc-205236 1 mg

CAY10415

Sign In for Pricing
View Details
Mouse Hydrocortisone,HYD ELISA Kit
CN-02573M2 48T

Mouse Hydrocortisone,HYD ELISA Kit

Sign In for Pricing
View Details
Recombinant Human SULF2 Protein, N-His
orb3056328-01 50 µg

Recombinant Human SULF2 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human SULF2 Protein, N-His
orb3056328-02 100 µg

Recombinant Human SULF2 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human SULF2 Protein, N-His
orb3056328-03 1 mg

Recombinant Human SULF2 Protein, N-His

Sign In for Pricing
View Details