Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human Orexin Receptor protein

This Human Orexin Receptor protein spans the amino acid sequence from region 1-46aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Hypocretin receptor type 1

UniProt

O43613

Expression Region

1-46aa

Tag

N-terminal 6xHis-sumostar-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Kidney
CS710404 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
Recombinant NUP62CL Antibody
RC-5544-01 50 μL

Recombinant NUP62CL Antibody

Sign In for Pricing
View Details
Recombinant NUP62CL Antibody
RC-5544-02 100 µL

Recombinant NUP62CL Antibody

Sign In for Pricing
View Details
Recombinant NUP62CL Antibody
RC-5544-03 1 mL

Recombinant NUP62CL Antibody

Sign In for Pricing
View Details
N-Acetyl-S-(2-cyanoethyl)-L-cysteine Ammonium Salt
TRC-A172083-5MG 5 mg

N-Acetyl-S-(2-cyanoethyl)-L-cysteine Ammonium Salt

Sign In for Pricing
View Details
KRT36 Polyclonal Antibody
E-AB-90667-01 60 µL

KRT36 Polyclonal Antibody

Sign In for Pricing
View Details