Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human Orexin Receptor protein

This Human Orexin Receptor protein spans the amino acid sequence from region 1-46aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Hypocretin receptor type 1

UniProt

O43613

Expression Region

1-46aa

Tag

N-terminal 6xHis-sumostar-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Disposable Cuvette
S4100-3 1000 Units/Case

Disposable Cuvette

Sign In for Pricing
View Details
NTA-FITC (90%)
TRC-N925000-10MG 10 mg

NTA-FITC (90%)

Sign In for Pricing
View Details
Calcium Hydroxide
TRC-C145580-5G 5 g

Calcium Hydroxide

Sign In for Pricing
View Details
BHLHE23 Human Gene Knockout Kit (CRISPR)
KN424722 1 Kit

BHLHE23 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Uroplakin 1B (Urothelial Differentiation Marker) (UPK1B/3273), Biotin conjugate, 0.1mg/mL
BNCB3273-100 1x 100 µL

Uroplakin 1B (Urothelial Differentiation Marker) (UPK1B/3273), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Aqp1 Mouse Gene Knockout Kit (CRISPR)
KN501448 1 Kit

Aqp1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details