Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CD48 protein

This Human CD48 protein spans the amino acid sequence from region 27-220aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

B-lymphocyte activation marker BLAST-1 BCM1 surface antigen Leukocyte antigen MEM-102 SLAM family member 2 Short name, SLAMF2 Signaling lymphocytic activation molecule 2 TCT.1 CD_antigen, CD48 BCM1, BLAST1

UniProt

P09326

Expression Region

27-220aa

Tag

N-terminal hFc-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

48.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKELQNSVLETTLMPHNYSRCYTCQVSNSVSSKNGTVCLSPPCTLARS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FMO5 siRNA (Mouse)
orb1847884-01 15 nmol

FMO5 siRNA (Mouse)

Sign In for Pricing
View Details
FMO5 siRNA (Mouse)
orb1847884-02 30 nmol

FMO5 siRNA (Mouse)

Sign In for Pricing
View Details
PTGER1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV700438 1.0 µg DNA

PTGER1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Hsa-miR-5579-5p miRNA Agomir
orb1919762-01 5 nmol

Hsa-miR-5579-5p miRNA Agomir

Sign In for Pricing
View Details
Hsa-miR-5579-5p miRNA Agomir
orb1919762-02 10 nmol

Hsa-miR-5579-5p miRNA Agomir

Sign In for Pricing
View Details
Hsa-miR-5579-5p miRNA Agomir
orb1919762-03 20 nmol

Hsa-miR-5579-5p miRNA Agomir

Sign In for Pricing
View Details