Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CD48 protein

This Human CD48 protein spans the amino acid sequence from region 27-220aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

B-lymphocyte activation marker BLAST-1 BCM1 surface antigen Leukocyte antigen MEM-102 SLAM family member 2 Short name, SLAMF2 Signaling lymphocytic activation molecule 2 TCT.1 CD_antigen, CD48 BCM1, BLAST1

UniProt

P09326

Expression Region

27-220aa

Tag

N-terminal hFc-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

48.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKELQNSVLETTLMPHNYSRCYTCQVSNSVSSKNGTVCLSPPCTLARS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACSM4 siRNA (Rat)
CRR5674-01 15 nmol

ACSM4 siRNA (Rat)

Sign In for Pricing
View Details
ACSM4 siRNA (Rat)
CRR5674-02 30 nmol

ACSM4 siRNA (Rat)

Sign In for Pricing
View Details
IFNG (Interferon, gamma, IFG, IFI)
247459 50 µg

IFNG (Interferon, gamma, IFG, IFI)

Sign In for Pricing
View Details
GLUD1 Double Nickase Plasmid (h2)
sc-402187-NIC-2 20 µg

GLUD1 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
IL15 (Interleukin 15, IL-15, MGC9721) (MaxLight 490)
MBS6206875-01 0.1 mL

IL15 (Interleukin 15, IL-15, MGC9721) (MaxLight 490)

Sign In for Pricing
View Details
IL15 (Interleukin 15, IL-15, MGC9721) (MaxLight 490)
MBS6206875-02 5x 0.1 mL

IL15 (Interleukin 15, IL-15, MGC9721) (MaxLight 490)

Sign In for Pricing
View Details