Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IGF1R protein

This Human IGF1R protein spans the amino acid sequence from region 763-931aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Insulin-like growth factor I receptor Short name, IGF-I receptor

UniProt

P08069

Expression Region

763-931aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YNITDPEELETEYPFFESRVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPVTWEPRPENSIFLKWPEPENPNGLILMYEIKYGSQVEDQRECVSRQEYRKYGGAKLNRLNPGNYTARIQATSLSGNGSWTDPVFFYVQAKTGYE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gm11568 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3330808 1.0 µg DNA

Gm11568 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Cav1 CRISPR Knock Out RAW264.7 Stable Cell Line (Mouse) T2-3
T9565 1x106 cells / 1.0 mL

Cav1 CRISPR Knock Out RAW264.7 Stable Cell Line (Mouse) T2-3

Sign In for Pricing
View Details
Rabbit Monoclonal Cystatin E/M/CST6 Antibody (022) [Biotin]
NBP2-89499B 0.1 mL

Rabbit Monoclonal Cystatin E/M/CST6 Antibody (022) [Biotin]

Sign In for Pricing
View Details
ARRB2 (Arrestin, beta 2, ARB2, ARR2, BARR2, DKFZp686L0365) (MaxLight 550)
MBS6215893-01 0.1 mL

ARRB2 (Arrestin, beta 2, ARB2, ARR2, BARR2, DKFZp686L0365) (MaxLight 550)

Sign In for Pricing
View Details
ARRB2 (Arrestin, beta 2, ARB2, ARR2, BARR2, DKFZp686L0365) (MaxLight 550)
MBS6215893-02 5x 0.1 mL

ARRB2 (Arrestin, beta 2, ARB2, ARR2, BARR2, DKFZp686L0365) (MaxLight 550)

Sign In for Pricing
View Details
SLUG, NT (K9) (Zinc Finger Protein SNAI2, Neural Crest Transcription Factor Slug, Protein Snail Homolog 2, SNAI2, SLUGH) (FITC)
MBS6499966-01 0.2 mL

SLUG, NT (K9) (Zinc Finger Protein SNAI2, Neural Crest Transcription Factor Slug, Protein Snail Homolog 2, SNAI2, SLUGH) (FITC)

Sign In for Pricing
View Details