Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IGF1R protein

This Human IGF1R protein spans the amino acid sequence from region 763-931aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Insulin-like growth factor I receptor Short name, IGF-I receptor

UniProt

P08069

Expression Region

763-931aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YNITDPEELETEYPFFESRVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPVTWEPRPENSIFLKWPEPENPNGLILMYEIKYGSQVEDQRECVSRQEYRKYGGAKLNRLNPGNYTARIQATSLSGNGSWTDPVFFYVQAKTGYE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

KIT (v-kit Hardy-Zuckerman 4 feline Sarcoma Viral Oncogene Homolog, C-Kit, CD117, PBT, SCFR) (MaxLight 405) discontinued
247930-ML405 100 µL

KIT (v-kit Hardy-Zuckerman 4 feline Sarcoma Viral Oncogene Homolog, C-Kit, CD117, PBT, SCFR) (MaxLight 405) discontinued

Sign In for Pricing
View Details
RAD23B Antibody
CSB-PA003914-01 50 µg

RAD23B Antibody

Sign In for Pricing
View Details
RAD23B Antibody
CSB-PA003914-02 100 µg

RAD23B Antibody

Sign In for Pricing
View Details
CREM Rabbit Polyclonal Antibody (APC)
orb994066 100 µL

CREM Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
Mmu-miR-8107 miRNA Mimic
CMM1883-01 5 nmol

Mmu-miR-8107 miRNA Mimic

Sign In for Pricing
View Details
Mmu-miR-8107 miRNA Mimic
CMM1883-02 10 nmol

Mmu-miR-8107 miRNA Mimic

Sign In for Pricing
View Details