Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IGF1R protein

This Human IGF1R protein spans the amino acid sequence from region 763-931aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Insulin-like growth factor I receptor Short name, IGF-I receptor

UniProt

P08069

Expression Region

763-931aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YNITDPEELETEYPFFESRVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPVTWEPRPENSIFLKWPEPENPNGLILMYEIKYGSQVEDQRECVSRQEYRKYGGAKLNRLNPGNYTARIQATSLSGNGSWTDPVFFYVQAKTGYE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTGES2 Antibody
MBS9521633-01 0.04 mL

PTGES2 Antibody

Sign In for Pricing
View Details
PTGES2 Antibody
MBS9521633-02 0.1 mL

PTGES2 Antibody

Sign In for Pricing
View Details
PTGES2 Antibody
MBS9521633-03 0.2 mL

PTGES2 Antibody

Sign In for Pricing
View Details
PTGES2 Antibody
MBS9521633-04 5x 0.2 mL

PTGES2 Antibody

Sign In for Pricing
View Details
C20orf4 (AAR2) Human siRNA Oligo Duplex (Locus ID 25980)
SR308639 1 Kit

C20orf4 (AAR2) Human siRNA Oligo Duplex (Locus ID 25980)

Sign In for Pricing
View Details
SNX4 AAV Vector (Rat) (CMV)
45082106 1 µg

SNX4 AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details