Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human FGF2 protein

This Human FGF2 protein spans the amino acid sequence from region 143-288aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Basic fibroblast growth factor Short name, bFGF Heparin-binding growth factor 2 Short name, HBGF-2

UniProt

P09038

Expression Region

143-288aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TP53 ELISA Kit (Human)
OKEH02945-96W 96 Well

TP53 ELISA Kit (Human)

Sign In for Pricing
View Details
Lentiviral human NUBP1 shRNA (UAS) - Lentiviral human NUBP1 shRNA (UAS, GFP) plasmid
GTR15313981 1 Vial

Lentiviral human NUBP1 shRNA (UAS) - Lentiviral human NUBP1 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
ADCY9 Antibody
CSB-PA178331 100 µL

ADCY9 Antibody

Sign In for Pricing
View Details
Human FBXW7 Pre-designed siRNA Set A
SI005576A 1 Each

Human FBXW7 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Human KRTAP4-12 (NM_031854) AAV Particle
RC200897A1V 250 µL

Human KRTAP4-12 (NM_031854) AAV Particle

Sign In for Pricing
View Details
Sodium 3-Sulfobenzoate
RG-S211212-01 10 mg

Sodium 3-Sulfobenzoate

Sign In for Pricing
View Details