Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human FGF2 protein

This Human FGF2 protein spans the amino acid sequence from region 143-288aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Basic fibroblast growth factor Short name, bFGF Heparin-binding growth factor 2 Short name, HBGF-2

UniProt

P09038

Expression Region

143-288aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Carbonic Anhydrase 10/CA10 (N-6His)
CE99-1mg 1 mg

Recombinant Human Carbonic Anhydrase 10/CA10 (N-6His)

Sign In for Pricing
View Details
Human DNA mismatch repair protein Msh6 (MSH6) ELISA Kit
orb1654187-01 48 Tests

Human DNA mismatch repair protein Msh6 (MSH6) ELISA Kit

Sign In for Pricing
View Details
Human DNA mismatch repair protein Msh6 (MSH6) ELISA Kit
orb1654187-02 96 Tests

Human DNA mismatch repair protein Msh6 (MSH6) ELISA Kit

Sign In for Pricing
View Details
2mL Screw capped MCT pk1000
TUB4510 1000 / PCK

2mL Screw capped MCT pk1000

Sign In for Pricing
View Details
5- (4-n-Propylphenyl) -5-oxovaleric acid
sc-336712A 25 g

5- (4-n-Propylphenyl) -5-oxovaleric acid

Sign In for Pricing
View Details
Porcine Fibroblast Growth Factor 9 (FGF9) High-Sensitivity ELISA Kit
IPCFGF9KTH 1 Each

Porcine Fibroblast Growth Factor 9 (FGF9) High-Sensitivity ELISA Kit

Sign In for Pricing
View Details