Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human FGF2 protein

This Human FGF2 protein spans the amino acid sequence from region 143-288aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Basic fibroblast growth factor Short name, bFGF Heparin-binding growth factor 2 Short name, HBGF-2

UniProt

P09038

Expression Region

143-288aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CHST2 antibody
STJ111813 100 µl

Anti-CHST2 antibody

Sign In for Pricing
View Details
ABHD6 Peptide
orb1233167 0.1 mg

ABHD6 Peptide

Sign In for Pricing
View Details
SEC22B 3'UTR Luciferase Stable Cell Line
TU022833 1.0 mL

SEC22B 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Anti-Human SYP/Synaptophysin Antibody (SAA1431), FITC
HY317117-01 1 Each

Anti-Human SYP/Synaptophysin Antibody (SAA1431), FITC

Sign In for Pricing
View Details
Anti-Human SYP/Synaptophysin Antibody (SAA1431), FITC
HY317117-02 100 Tests

Anti-Human SYP/Synaptophysin Antibody (SAA1431), FITC

Sign In for Pricing
View Details
CXCL12, CT (CXCL12, SDF1, SDF1A, SDF1B, Stromal cell-derived factor 1, C-X-C motif chemokine 12, Intercrine reduced in hepatomas, Pre-B cell growth-stimulating factor, SDF-1-beta(3-72), SDF-1-alpha(3-67)) (Azide free) (HRP)
MBS6290203-01 0.2 mL

CXCL12, CT (CXCL12, SDF1, SDF1A, SDF1B, Stromal cell-derived factor 1, C-X-C motif chemokine 12, Intercrine reduced in hepatomas, Pre-B cell growth-stimulating factor, SDF-1-beta(3-72), SDF-1-alpha(3-67)) (Azide free) (HRP)

Sign In for Pricing
View Details