Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli ompT protein

This E. coli ompT protein spans the amino acid sequence from region 21-317aa (G216K, K217G) . Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Omptin Outer membrane protein 3B Protease A Protease VII

UniProt

P58603

Expression Region

21-317aa (G216K, K217G)

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Escherichia coli O157:H7

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

49.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

STETLSFTPDNINADISLGTLSGKTKERVYLAEEGGRKVSQLDWKFNNAAIIKGAINWDLMPQISIGAAGWTTLGSRGGNMVDQDWMDSSNPGTWTDESRHPDTQLNYANEFDLNIKGWLLNEPNYRLGLMAGYQESRYSFTARGGSYIYSSEEGFRDDIGSFPNGERAIGYKQRFKMPYIGLTGSYRYEDFELGGTFKYSGWVEASDNDEHYDPKGRITYRSKVKDQNYYSVSVNAGYYVTPNAKVYVEGTWNRVTNKKGNTSLYDHNDNTSDYSKNGAGIENYNFITTAGLKYTF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

KCNG3 Protein Lysate
OCOA06680-20UG 20 µg

KCNG3 Protein Lysate

Sign In for Pricing
View Details
Lentiviral human MSRB2 sgRNA gene knockout kit - Lentiviral human MSRB2 sgRNA gene knockout kit (25)
GTR15387882 1 Vial

Lentiviral human MSRB2 sgRNA gene knockout kit - Lentiviral human MSRB2 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Hsa-miR-3976 agomir
HY-R00914A-01 5 nmol

Hsa-miR-3976 agomir

Sign In for Pricing
View Details
Hsa-miR-3976 agomir
HY-R00914A-02 20 nmol

Hsa-miR-3976 agomir

Sign In for Pricing
View Details
Ethyl 3-aminothieno[2,3-c]pyridine-2-carboxylate
sc-263228 500 mg

Ethyl 3-aminothieno[2,3-c]pyridine-2-carboxylate

Sign In for Pricing
View Details
Goat Prostaglandin F1alpha (PGF1alpha) ELISA Kit
MBS264883-01 48 Well

Goat Prostaglandin F1alpha (PGF1alpha) ELISA Kit

Sign In for Pricing
View Details