Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli ompT protein

This E. coli ompT protein spans the amino acid sequence from region 21-317aa (G216K, K217G) . Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Omptin Outer membrane protein 3B Protease A Protease VII

UniProt

P58603

Expression Region

21-317aa (G216K, K217G)

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Escherichia coli O157:H7

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

49.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

STETLSFTPDNINADISLGTLSGKTKERVYLAEEGGRKVSQLDWKFNNAAIIKGAINWDLMPQISIGAAGWTTLGSRGGNMVDQDWMDSSNPGTWTDESRHPDTQLNYANEFDLNIKGWLLNEPNYRLGLMAGYQESRYSFTARGGSYIYSSEEGFRDDIGSFPNGERAIGYKQRFKMPYIGLTGSYRYEDFELGGTFKYSGWVEASDNDEHYDPKGRITYRSKVKDQNYYSVSVNAGYYVTPNAKVYVEGTWNRVTNKKGNTSLYDHNDNTSDYSKNGAGIENYNFITTAGLKYTF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Phosphatidylinositol 4-Kinase Type 2-Beta (PI4K2B) ELISA Kit
MBS9945065 Inquire

Rabbit Phosphatidylinositol 4-Kinase Type 2-Beta (PI4K2B) ELISA Kit

Sign In for Pricing
View Details
MUCL1 Antibody
OACA06329-50UG 50 µg

MUCL1 Antibody

Sign In for Pricing
View Details
Scamp2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6972508 1.0 µg DNA

Scamp2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Stmn3 sgRNA CRISPR Lentivector set (Mouse)
K3391901 3x 1.0 µg

Stmn3 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Recombinant Clostridium Cellulolyticum xseA Protein (aa 1-404)
VAng-Lsx9068-1mgEcoli 1 mg (E. coli)

Recombinant Clostridium Cellulolyticum xseA Protein (aa 1-404)

Sign In for Pricing
View Details
Urolithin M6
TRC-U847040-100MG 100 mg

Urolithin M6

Sign In for Pricing
View Details