Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sheep IL4 protein

This Sheep IL4 protein spans the amino acid sequence from region 25-135aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

B-cell stimulatory factor 1

UniProt

P30368

Expression Region

25-135aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Ovis aries (Sheep)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

HKCDITLEEIIKTLNILTSRKNSCMELPVADVFAAPKNATEKETFCRAGIELRRIYRSHMCLNKFLGGLDRNLSSLASKTCSVNEAKTSTSTLRDLLERLKTIMREKYSKC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VMA21 Antibody
orb620343 100 µL

VMA21 Antibody

Sign In for Pricing
View Details
Mouse Monoclonal TGF-beta RIII Antibody (MM0057-5G9) [Alexa Fluor 750]
NBP2-11920AF750 0.1 mL

Mouse Monoclonal TGF-beta RIII Antibody (MM0057-5G9) [Alexa Fluor 750]

Sign In for Pricing
View Details
ZBED6 rabbit pAb
ES12237-01 50 µL

ZBED6 rabbit pAb

Sign In for Pricing
View Details
ZBED6 rabbit pAb
ES12237-02 100 µL

ZBED6 rabbit pAb

Sign In for Pricing
View Details
Cell Cycle Kit for fixed cell (FAC Red) (PI/RNase A solution)
EGY0093 100 Tests

Cell Cycle Kit for fixed cell (FAC Red) (PI/RNase A solution)

Sign In for Pricing
View Details
Human TORC3/CRTC3 - Ready-To-Use ELISA Kit (Colorimetric)
NBP3-31302 1 Kit

Human TORC3/CRTC3 - Ready-To-Use ELISA Kit (Colorimetric)

Sign In for Pricing
View Details