Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sheep IL4 protein

This Sheep IL4 protein spans the amino acid sequence from region 25-135aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

B-cell stimulatory factor 1

UniProt

P30368

Expression Region

25-135aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Ovis aries (Sheep)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

HKCDITLEEIIKTLNILTSRKNSCMELPVADVFAAPKNATEKETFCRAGIELRRIYRSHMCLNKFLGGLDRNLSSLASKTCSVNEAKTSTSTLRDLLERLKTIMREKYSKC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATP5J2P3 Protein Vector (Human) (pPM-N-D-C-His)
PV325277 500 ng

ATP5J2P3 Protein Vector (Human) (pPM-N-D-C-His)

Sign In for Pricing
View Details
Lentiviral mouse Psmb1 shRNA (UAS) - Lentiviral mousePsmb1 shRNA (UAS, GFP) (25)
GTR15305231 1 Vial

Lentiviral mouse Psmb1 shRNA (UAS) - Lentiviral mousePsmb1 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
XCR1, CT (XCR1, CCXCR1, GPR5, Chemokine XC receptor 1, G-protein coupled receptor 5, Lymphotactin receptor, XC chemokine receptor 1) (MaxLight 405) discontinued
043915-ML405 100 µL

XCR1, CT (XCR1, CCXCR1, GPR5, Chemokine XC receptor 1, G-protein coupled receptor 5, Lymphotactin receptor, XC chemokine receptor 1) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Porcine CTXI (Cross Linked C-telopeptide of Type I Collagen) QuickTest ELISA Kit
QT-EP0217 96 Tests

Porcine CTXI (Cross Linked C-telopeptide of Type I Collagen) QuickTest ELISA Kit

Sign In for Pricing
View Details
Recombinant Mycobacterium Leprae rpmH Protein (aa 1-47)
VAng-Yyj2365-50gEcoli 50 µg (E. coli)

Recombinant Mycobacterium Leprae rpmH Protein (aa 1-47)

Sign In for Pricing
View Details
Ethyl 2- (hydroxymethyl) -4,4-dimethylpentanoate
HEA74964-01 50 mg

Ethyl 2- (hydroxymethyl) -4,4-dimethylpentanoate

Sign In for Pricing
View Details