Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fungi mitF protein

This Fungi mitF protein spans the amino acid sequence from region 28-176aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Allergen Asp f I Allergen I/a IgE-binding ribotoxin Major allergen Asp f 1 Allergen, Asp f 1 aspF1

UniProt

P67875

Expression Region

28-176aa

Tag

N-terminal 6xHis-SUMO-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus)

Field of Research

Infectious Disease & Virology; Stem Cell & Developmental Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ATWTCINQQLNPKTNKWEDKRLLYSQAKAESNSHHAPLSDGKTGSSYPHWFTNGYDGNGKLIKGRTPIKFGKADCDRPPKHSQNGMGKDDHYLLEFPTFPDGHDYKFDSKKPKEDPGPARVIYTYPNKVFCGIVAHQRGNQGDLRLCSH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Pellino 1 (PELI1) activation kit by CRISPRa
GA111419 1 Kit

Human Pellino 1 (PELI1) activation kit by CRISPRa

Sign In for Pricing
View Details
STAU1 Rabbit Monoclonal Antibody [Clone ID: 24GB5095]
TA425248 100 µL

STAU1 Rabbit Monoclonal Antibody [Clone ID: 24GB5095]

Sign In for Pricing
View Details
Rabbit Polyclonal Antibody
TA397417 100 µg

Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Carboxypeptidase M (CPM) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI7C1]
TA807285AM 100 µL

Carboxypeptidase M (CPM) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI7C1]

Sign In for Pricing
View Details
Human XKR9 activation kit by CRISPRa
GA118067 1 Kit

Human XKR9 activation kit by CRISPRa

Sign In for Pricing
View Details
C17orf87 (SCIMP) (NM_207103) Human Over-expression Lysate
LC404112 20 µg

C17orf87 (SCIMP) (NM_207103) Human Over-expression Lysate

Sign In for Pricing
View Details