Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fungi mitF protein

This Fungi mitF protein spans the amino acid sequence from region 28-176aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Allergen Asp f I Allergen I/a IgE-binding ribotoxin Major allergen Asp f 1 Allergen, Asp f 1 aspF1

UniProt

P67875

Expression Region

28-176aa

Tag

N-terminal 6xHis-SUMO-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus)

Field of Research

Infectious Disease & Virology; Stem Cell & Developmental Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ATWTCINQQLNPKTNKWEDKRLLYSQAKAESNSHHAPLSDGKTGSSYPHWFTNGYDGNGKLIKGRTPIKFGKADCDRPPKHSQNGMGKDDHYLLEFPTFPDGHDYKFDSKKPKEDPGPARVIYTYPNKVFCGIVAHQRGNQGDLRLCSH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-PLC-gamma-1 (Y783) Recombinant Rabbit Monoclonal Antibody [PSH06-29]
HA722661 100 µL

Phospho-PLC-gamma-1 (Y783) Recombinant Rabbit Monoclonal Antibody [PSH06-29]

Sign In for Pricing
View Details
Drosha Mouse Gene Knockout Kit (CRISPR)
KN304817RB 1 Kit

Drosha Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Benzyl 6-Oxohexanoate
TRC-B279260-500MG 500 mg

Benzyl 6-Oxohexanoate

Sign In for Pricing
View Details
WDR77 Rabbit Polyclonal Antibody
TA365154 100 µL

WDR77 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ELL3 Rabbit polyclonal Antibody
HA500564 100 µL

ELL3 Rabbit polyclonal Antibody

Sign In for Pricing
View Details
Human TRIM58 activation kit by CRISPRa
GA108610 1 Kit

Human TRIM58 activation kit by CRISPRa

Sign In for Pricing
View Details