Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human FPR1 protein

This Human FPR1 protein spans the amino acid sequence from region 306-350aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

N-formyl peptide receptor Short name, FPR N-formylpeptide chemoattractant receptor

UniProt

P21462

Expression Region

306-350aa

Tag

N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QDFRERLIHALPASLERALTEDSTQTSDTATNSTLPSAEVELQAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Activin Receptor-Like Kinase 1 (ALK1) ELISA Kit
MBS9714570-01 48 Tests

Human Activin Receptor-Like Kinase 1 (ALK1) ELISA Kit

Sign In for Pricing
View Details
Human Activin Receptor-Like Kinase 1 (ALK1) ELISA Kit
MBS9714570-02 96 Tests

Human Activin Receptor-Like Kinase 1 (ALK1) ELISA Kit

Sign In for Pricing
View Details
Human Activin Receptor-Like Kinase 1 (ALK1) ELISA Kit
MBS9714570-03 5x 96 Tests

Human Activin Receptor-Like Kinase 1 (ALK1) ELISA Kit

Sign In for Pricing
View Details
Quick Step Human soluble vasccular cell adhesion molecule 1, sVCAM-1 Elisa Kit
QS1626Hu-01 48 Tests

Quick Step Human soluble vasccular cell adhesion molecule 1, sVCAM-1 Elisa Kit

Sign In for Pricing
View Details
Quick Step Human soluble vasccular cell adhesion molecule 1, sVCAM-1 Elisa Kit
QS1626Hu-02 96 Tests

Quick Step Human soluble vasccular cell adhesion molecule 1, sVCAM-1 Elisa Kit

Sign In for Pricing
View Details
GTPBP10 (NM_001042717) Human Over-expression Lysate
LS085865-100ug 100 µg

GTPBP10 (NM_001042717) Human Over-expression Lysate

Sign In for Pricing
View Details