Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human FPR1 protein

This Human FPR1 protein spans the amino acid sequence from region 306-350aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

N-formyl peptide receptor Short name, FPR N-formylpeptide chemoattractant receptor

UniProt

P21462

Expression Region

306-350aa

Tag

N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QDFRERLIHALPASLERALTEDSTQTSDTATNSTLPSAEVELQAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HLA-DMB (Major Histocompatibility Complex, Class II, DM beta, D6S221E, RING7) (Biotin)
MBS6173004-01 0.1 mL

HLA-DMB (Major Histocompatibility Complex, Class II, DM beta, D6S221E, RING7) (Biotin)

Sign In for Pricing
View Details
HLA-DMB (Major Histocompatibility Complex, Class II, DM beta, D6S221E, RING7) (Biotin)
MBS6173004-02 5x 0.1 mL

HLA-DMB (Major Histocompatibility Complex, Class II, DM beta, D6S221E, RING7) (Biotin)

Sign In for Pricing
View Details
BMPR1B Protein Lysate (Mouse) with C-HA Tag
13378034 100 µg

BMPR1B Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
Vaccaroid A
MBS5790954 Inquire

Vaccaroid A

Sign In for Pricing
View Details
MALT1-IN-3
HY-143422 1 Each

MALT1-IN-3

Sign In for Pricing
View Details
RBBP8 Rabbit Polyclonal Antibody (FITC)
orb2582884 100 µg

RBBP8 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details