Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human HEATR6 protein

This Human HEATR6 protein spans the amino acid sequence from region 1052-1175aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Amplified in breast cancer protein 1 ABC1

UniProt

Q6AI08

Expression Region

1052-1175aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KSEDTIDFLEFKYCVSLRTQICQALIHLLSLASASDLPCMKETLELSGNMVQSYILQFLKSGAEGDDTGAPHSPQERDQMVRMALKHMGSIQAPTGDTARRAIMGFLEEILAVCFDSSGSQGAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-RABEPK antibody
PAab07056 100 µg

Anti-RABEPK antibody

Sign In for Pricing
View Details
ZNF213 Mouse Monoclonal Antibody [Clone ID: OTI1A12]
TA810318S 30 µL

ZNF213 Mouse Monoclonal Antibody [Clone ID: OTI1A12]

Sign In for Pricing
View Details
Senp18 (NM_001002834) Rat Tagged Lenti ORF Clone
RR213940L4 10 µg

Senp18 (NM_001002834) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O139:H28 (strain E24377A/ETEC) CYOE Polyclonal Antibody
MBS7138611 Inquire

Rabbit anti-Escherichia coli O139:H28 (strain E24377A/ETEC) CYOE Polyclonal Antibody

Sign In for Pricing
View Details
CD107a/LAMP1 Human Monoclonal Antibody
orb2976816-01 100 µg

CD107a/LAMP1 Human Monoclonal Antibody

Sign In for Pricing
View Details
CD107a/LAMP1 Human Monoclonal Antibody
orb2976816-02 1 mg

CD107a/LAMP1 Human Monoclonal Antibody

Sign In for Pricing
View Details