Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human HEATR6 protein

This Human HEATR6 protein spans the amino acid sequence from region 1052-1175aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Amplified in breast cancer protein 1 ABC1

UniProt

Q6AI08

Expression Region

1052-1175aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KSEDTIDFLEFKYCVSLRTQICQALIHLLSLASASDLPCMKETLELSGNMVQSYILQFLKSGAEGDDTGAPHSPQERDQMVRMALKHMGSIQAPTGDTARRAIMGFLEEILAVCFDSSGSQGAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BRD7 Recombinant Protein (Human)
RP003184 100 µg

BRD7 Recombinant Protein (Human)

Sign In for Pricing
View Details
Benzodiazepines (BZO) Rapid Test Device-urine
D-RDOA5D40 40 Tests

Benzodiazepines (BZO) Rapid Test Device-urine

Sign In for Pricing
View Details
PRL Peptide - middle region (AAP80410)
AAP80410-100UG 100 µg

PRL Peptide - middle region (AAP80410)

Sign In for Pricing
View Details
PI 4-Kinase, beta (APC) discontinued
P4186-25-APC 100 µL

PI 4-Kinase, beta (APC) discontinued

Sign In for Pricing
View Details
Bacillus cereus gajA Protein (N-His, Bacillus cereus)
P500884 100 µg

Bacillus cereus gajA Protein (N-His, Bacillus cereus)

Sign In for Pricing
View Details
Penta-O-acetyl-D-fructose diethyldithioacetal
MP05751-01 500 mg

Penta-O-acetyl-D-fructose diethyldithioacetal

Sign In for Pricing
View Details