Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ACP1 protein

This Human ACP1 protein spans the amino acid sequence from region 1-158aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Adipocyte acid phosphatase Low molecular weight cytosolic acid phosphatase (EC, 3.1.3.2) Red cell acid phosphatase 1

UniProt

P24666

Expression Region

1-158aa

Tag

Tag-Free

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Swing Out Rotor 4 x 100 ml
100UC3A0401MLS 1 Unit

Swing Out Rotor 4 x 100 ml

Sign In for Pricing
View Details
GATAD1 Peptide
MBS3226398-01 0.1 mg

GATAD1 Peptide

Sign In for Pricing
View Details
GATAD1 Peptide
MBS3226398-02 5x 0.1 mg

GATAD1 Peptide

Sign In for Pricing
View Details
TNNI3 ELISA Kit (Dog) (OKEH07405)
OKEH07405 96 Well

TNNI3 ELISA Kit (Dog) (OKEH07405)

Sign In for Pricing
View Details
TREM1 ELISA Kit (Human) : 96 Wells (OKEH00303)
OKEH00303 96 Well

TREM1 ELISA Kit (Human) : 96 Wells (OKEH00303)

Sign In for Pricing
View Details
RCA1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1802506 1.0 µg DNA

RCA1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details