Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ACP1 protein

This Human ACP1 protein spans the amino acid sequence from region 1-158aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Adipocyte acid phosphatase Low molecular weight cytosolic acid phosphatase (EC, 3.1.3.2) Red cell acid phosphatase 1

UniProt

P24666

Expression Region

1-158aa

Tag

Tag-Free

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRB-1 HDR Plasmid (m)
sc-431763-HDR 20 µg

TRB-1 HDR Plasmid (m)

Sign In for Pricing
View Details
Spef1 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K3557802 1.0 µg DNA

Spef1 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Human Renal Carcinoma Wilms Cells [G-401]
AFG-ELL-3246 > 1x 10^6 Cells / Vial

Human Renal Carcinoma Wilms Cells [G-401]

Sign In for Pricing
View Details
1,3,6,8-Pyrenetetrasulfonic Acid Tetrasodium Salt
411220-01 1 g

1,3,6,8-Pyrenetetrasulfonic Acid Tetrasodium Salt

Sign In for Pricing
View Details
1,3,6,8-Pyrenetetrasulfonic Acid Tetrasodium Salt
411220-02 2.5 g

1,3,6,8-Pyrenetetrasulfonic Acid Tetrasodium Salt

Sign In for Pricing
View Details
Rat Apolipoprotein A-V, Apo-AV ELISA Kit
MBS9428934-01 96 Tests

Rat Apolipoprotein A-V, Apo-AV ELISA Kit

Sign In for Pricing
View Details