Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ARID1A protein

This Human ARID1A protein spans the amino acid sequence from region 1976-2231aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

B120 BRG1-associated factor 250 Short name, BAF250 BRG1-associated factor 250a Short name, BAF250A Osa homolog 1 Short name, hOSA1 SWI-like protein SWI/SNF complex protein p270 SWI/SNF-related, matrix-associated, actin-dependent regulator of chromatin subfamily F member 1 hELD C1orf4, OSA1, SMARCF1

UniProt

O14497

Expression Region

1976-2231aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SLAKRCVCVSNTIRSLSFVPGNDFEMSKHPGLLLILGKLILLHHKHPERKQAPLTYEKEEEQDQGVSCNKVEWWWDCLEMLRENTLVTLANISGQLDLSPYPESICLPVLDGLLHWAVCPSAEAQDPFSTLGPNAVLSPQRLVLETLSKLSIQDNNVDLILATPPFSRLEKLYSTMVRFLSDRKNPVCREMAVVLLANLAQGDSLAARAIAVQKGSIGNLLGFLEDSLAATQFQQSQASLLHMQNPPFEPTSVDMM

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DIO2 Protein Vector (Mouse) (pPB-C-His)
PV172090 500 ng

DIO2 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
ML 00253764 hydrochloride
4854/50 50 mg

ML 00253764 hydrochloride

Sign In for Pricing
View Details
Calbindin D28, Antibody
GWB-AE74B2 1 mL

Calbindin D28, Antibody

Sign In for Pricing
View Details
hsa-miR-891a-3p miRNA Mimic
MBS8300131-01 5 nmol

hsa-miR-891a-3p miRNA Mimic

Sign In for Pricing
View Details
hsa-miR-891a-3p miRNA Mimic
MBS8300131-02 10 nmol

hsa-miR-891a-3p miRNA Mimic

Sign In for Pricing
View Details
hsa-miR-891a-3p miRNA Mimic
MBS8300131-03 5x 10 nmol

hsa-miR-891a-3p miRNA Mimic

Sign In for Pricing
View Details