Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Plant WAXY protein

This Plant WAXY protein spans the amino acid sequence from region 79-349aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Granule-bound starch synthase I Short name, GBSS-I

UniProt

P27736

Expression Region

79-349aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Triticum aestivum (Wheat)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LVFVGAEMAPWSKTGGLGDVLGGLPAAMAANGHRVMVISPRYDQYKDAWDTSVISEIKVVDRYERVRYFHCYKRGVDRVFVDHPCFLEKVRGKTKEKIYGPDAGTDYEDNQQRFSLLCQAALEVPRILDLNNNPHFSGPYAMLCRAVPRRAGEDVVFVCNDWHTGLLACYLKSNYQSNGIYRTAKVAFCIHNISYQGRFSFDDFAQLNLPDRFKSSFDFIDGYDKPVEGRKINWMKAGILQADKVLTVSPYYAEELISGEARGCELDNIMR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Bromo-2,2,5,5-tetramethyl-3- (methylsulfonylmethyl) -2,5-dihydro-1H-pyrrol-1-yloxyl Radical_x000B_
MBS6060270-01 10 mg

4-Bromo-2,2,5,5-tetramethyl-3- (methylsulfonylmethyl) -2,5-dihydro-1H-pyrrol-1-yloxyl Radical_x000B_

Sign In for Pricing
View Details
4-Bromo-2,2,5,5-tetramethyl-3- (methylsulfonylmethyl) -2,5-dihydro-1H-pyrrol-1-yloxyl Radical_x000B_
MBS6060270-02 5x 10 mg

4-Bromo-2,2,5,5-tetramethyl-3- (methylsulfonylmethyl) -2,5-dihydro-1H-pyrrol-1-yloxyl Radical_x000B_

Sign In for Pricing
View Details
EGFR discontinued
399931-01 50 µL

EGFR discontinued

Sign In for Pricing
View Details
EGFR discontinued
399931-02 100 µL

EGFR discontinued

Sign In for Pricing
View Details
Phospho-CREB (Ser 133) Rabbit mAb
C06259-20uL 20 µL

Phospho-CREB (Ser 133) Rabbit mAb

Sign In for Pricing
View Details
Anti-SETD7 Antibody (2K36)
TMAY-01754 100 µL

Anti-SETD7 Antibody (2K36)

Sign In for Pricing
View Details