Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fish Oncorhynchus keta L-rhamnose-binding lectin CSL3 protein

This Fish Oncorhynchus keta L-rhamnose-binding lectin CSL3 protein spans the amino acid sequence from region 1-195aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

L-rhamnose-binding lectin CSL3

UniProt

P86179

Expression Region

1-195aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Oncorhynchus keta (Chum salmon) (Salmo keta)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AISITCEGSDALLQCDGAKIHIKRANYGRRQHDVCSIGRPDNQLTDTNCLSQSSTSKMAERCGGKSECIVPASNFVFGDPCVGTYKYLDTKYSCVQQQETISSIICEGSDSQLLCDRGEIRIQRANYGRRQHDVCSIGRPHQQLKNTNCLSQSTTSKMAERCDGKRQCIVSVSNSVFGDPCVGTYKYLDVAYTCD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CTPS2 Antibody, HRP conjugated
A67232-50UG 50 µg

CTPS2 Antibody, HRP conjugated

Sign In for Pricing
View Details
Nuf2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
32308114 3x 1.0 µg

Nuf2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
TEX13A (Testis-expressed Sequence 13A Protein) (PE)
134342-PE 100 µL

TEX13A (Testis-expressed Sequence 13A Protein) (PE)

Sign In for Pricing
View Details
BDP 581/591 NHS ester
orb1982057-01 50 mg

BDP 581/591 NHS ester

Sign In for Pricing
View Details
BDP 581/591 NHS ester
orb1982057-02 100 mg

BDP 581/591 NHS ester

Sign In for Pricing
View Details
BDP 581/591 NHS ester
orb1982057-03 25 mg

BDP 581/591 NHS ester

Sign In for Pricing
View Details