Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MPZ protein

This Human MPZ protein spans the amino acid sequence from region 30-156aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Myelin peripheral protein , MPPMyelin protein zero

UniProt

P25189

Expression Region

30-156aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IVVYTDREVHGAVGSRVTLHCSFWSSEWVSDDISFTWRYQPEGGRDAISIFHYAKGQPYIDEVGTFKERIQWVGDPRWKDGSIVIHNLDYSDNGTFTCDVKNPPDIVGKTSQVTLYVFEKVPTRYGV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPP4R1L, NT (PPP4R1L, C20orf192, Putative serine/threonine-protein phosphatase 4 regulatory subunit 1-like) (AP)
MBS6336731-01 0.2 mL

PPP4R1L, NT (PPP4R1L, C20orf192, Putative serine/threonine-protein phosphatase 4 regulatory subunit 1-like) (AP)

Sign In for Pricing
View Details
PPP4R1L, NT (PPP4R1L, C20orf192, Putative serine/threonine-protein phosphatase 4 regulatory subunit 1-like) (AP)
MBS6336731-02 5x 0.2 mL

PPP4R1L, NT (PPP4R1L, C20orf192, Putative serine/threonine-protein phosphatase 4 regulatory subunit 1-like) (AP)

Sign In for Pricing
View Details
Apoptosis regulator BAX Bax Rabbit Polyclonal Antibody
orb623710 100 µg

Apoptosis regulator BAX Bax Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-GPR160 Antibody
MBS4509343-01 0.05 mL

Rabbit anti-GPR160 Antibody

Sign In for Pricing
View Details
Rabbit anti-GPR160 Antibody
MBS4509343-02 0.1 mL

Rabbit anti-GPR160 Antibody

Sign In for Pricing
View Details
Rabbit anti-GPR160 Antibody
MBS4509343-03 5x 0.1 mL

Rabbit anti-GPR160 Antibody

Sign In for Pricing
View Details