Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MPZ protein

This Human MPZ protein spans the amino acid sequence from region 30-156aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Myelin peripheral protein , MPPMyelin protein zero

UniProt

P25189

Expression Region

30-156aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IVVYTDREVHGAVGSRVTLHCSFWSSEWVSDDISFTWRYQPEGGRDAISIFHYAKGQPYIDEVGTFKERIQWVGDPRWKDGSIVIHNLDYSDNGTFTCDVKNPPDIVGKTSQVTLYVFEKVPTRYGV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ViPrimePLUS Mycoplasma pneumoniae qPCR Kit
QM2044 150 Reactions

ViPrimePLUS Mycoplasma pneumoniae qPCR Kit

Sign In for Pricing
View Details
MMP8 Recombinant Rabbit Monoclonal Antibody pair (detector)
orb2563251 100 µg

MMP8 Recombinant Rabbit Monoclonal Antibody pair (detector)

Sign In for Pricing
View Details
Anti-Spike-RBD fully human mAb (IgG)
MBS8574934-01 0.05 mg

Anti-Spike-RBD fully human mAb (IgG)

Sign In for Pricing
View Details
Anti-Spike-RBD fully human mAb (IgG)
MBS8574934-02 5x 0.05 mg

Anti-Spike-RBD fully human mAb (IgG)

Sign In for Pricing
View Details
PRDM14 ORF Vector (Human) (pORF)
ORF008170 1.0 µg DNA

PRDM14 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
IgG1 Murine Negative Isotype Control (For rat tissue) (FITC)
I1904-78X 100 µg

IgG1 Murine Negative Isotype Control (For rat tissue) (FITC)

Sign In for Pricing
View Details