Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MPZ protein

This Human MPZ protein spans the amino acid sequence from region 30-156aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Myelin peripheral protein , MPPMyelin protein zero

UniProt

P25189

Expression Region

30-156aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IVVYTDREVHGAVGSRVTLHCSFWSSEWVSDDISFTWRYQPEGGRDAISIFHYAKGQPYIDEVGTFKERIQWVGDPRWKDGSIVIHNLDYSDNGTFTCDVKNPPDIVGKTSQVTLYVFEKVPTRYGV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MMP9, CT (Matrix Metalloproteinase-9, MMP-9, 92kD type IV Collagenase, 92kD Gelatinase, Gelatinase B, GELB, CLG4B) (Biotin) discontinued
M2425-02B-Biotin 200 µL

MMP9, CT (Matrix Metalloproteinase-9, MMP-9, 92kD type IV Collagenase, 92kD Gelatinase, Gelatinase B, GELB, CLG4B) (Biotin) discontinued

Sign In for Pricing
View Details
SPATA7 Human Over-expression Lysate
orb1369909 20 µg

SPATA7 Human Over-expression Lysate

Sign In for Pricing
View Details
SNF8 (Vacuolar-sorting Protein SNF8, ELL-associated Protein of 30kD, EAP30, ESCRT-II Complex Subunit VPS22, hVps22, Dot3) APC
MBS6394609-01 0.1 mL

SNF8 (Vacuolar-sorting Protein SNF8, ELL-associated Protein of 30kD, EAP30, ESCRT-II Complex Subunit VPS22, hVps22, Dot3) APC

Sign In for Pricing
View Details
SNF8 (Vacuolar-sorting Protein SNF8, ELL-associated Protein of 30kD, EAP30, ESCRT-II Complex Subunit VPS22, hVps22, Dot3) APC
MBS6394609-02 5x 0.1 mL

SNF8 (Vacuolar-sorting Protein SNF8, ELL-associated Protein of 30kD, EAP30, ESCRT-II Complex Subunit VPS22, hVps22, Dot3) APC

Sign In for Pricing
View Details
TPM3-ALK Mutant, Active
MBS515449-01 0.01 mg

TPM3-ALK Mutant, Active

Sign In for Pricing
View Details
TPM3-ALK Mutant, Active
MBS515449-02 0.05 mg

TPM3-ALK Mutant, Active

Sign In for Pricing
View Details