Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human GYPA protein

This Human GYPA protein spans the amino acid sequence from region 20-91aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MN sialoglycoprotein, PAS-2Sialoglycoprotein alpha, CD235a

UniProt

A0A0C4DFT7

Expression Region

20-91aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

12 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LSTTEVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GNPAT Mouse Monoclonal Antibody [Clone ID: OTI2F8]
CF811143 100 µg

GNPAT Mouse Monoclonal Antibody [Clone ID: OTI2F8]

Sign In for Pricing
View Details
RAD51 (Prognostic and Response to Chemotherapy Marker) (RAD51/2765), CF640R conjugate, 0.1mg/mL
BNC402765-500 1x 500 µL

RAD51 (Prognostic and Response to Chemotherapy Marker) (RAD51/2765), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
p19 INK4d (CDKN2D) (NM_001800) Human Over-expression Lysate
LC400682 20 µg

p19 INK4d (CDKN2D) (NM_001800) Human Over-expression Lysate

Sign In for Pricing
View Details
KIR5.1 (KCNJ16) Rabbit Polyclonal Antibody
TA377719 100 µL

KIR5.1 (KCNJ16) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue Total RNA, Lymphoid tissue
CR561899 5 µg

Tissue Total RNA, Lymphoid tissue

Sign In for Pricing
View Details
EPO Mouse Monoclonal Antibody [Clone ID: 85]
AM33423PU-N 500 µg

EPO Mouse Monoclonal Antibody [Clone ID: 85]

Sign In for Pricing
View Details