Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human GYPA protein

This Human GYPA protein spans the amino acid sequence from region 20-91aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MN sialoglycoprotein, PAS-2Sialoglycoprotein alpha, CD235a

UniProt

A0A0C4DFT7

Expression Region

20-91aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

12 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LSTTEVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human EFHB activation kit by CRISPRa
GA115804 1 Kit

Human EFHB activation kit by CRISPRa

Sign In for Pricing
View Details
IL15 Antibody
KC-1736-01 50 μL

IL15 Antibody

Sign In for Pricing
View Details
IL15 Antibody
KC-1736-02 100 µL

IL15 Antibody

Sign In for Pricing
View Details
IL15 Antibody
KC-1736-03 1 mL

IL15 Antibody

Sign In for Pricing
View Details
Cathepsin K (Marker of Tumor Invasiveness) (CTSK/2791), CF640R conjugate, 0.1mg/mL
BNC402791-100 1x 100 µL

Cathepsin K (Marker of Tumor Invasiveness) (CTSK/2791), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
OPCmL (NM_002545) Human Over-expression Lysate
LC419251 20 µg

OPCmL (NM_002545) Human Over-expression Lysate

Sign In for Pricing
View Details