Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SCRG1 protein

This Human SCRG1 protein spans the amino acid sequence from region 21-98aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Scrapie-responsive gene 1 protein , ScRG-1

UniProt

O75711

Expression Region

21-98aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

12.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPANRLSCYRKILKDHNCHNLPEGVADLTQIDVNVQDHFWDGKGCEMICYCNFSELLCCPKDVFFGPKISFVIPCNNQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL6B Antibody
orb849329 2 mg

RPL6B Antibody

Sign In for Pricing
View Details
NTF3 siRNA Oligos set (Human)
32235171 3x 5 nmol

NTF3 siRNA Oligos set (Human)

Sign In for Pricing
View Details
PTGR1 CytoSection
TS428235P5 25 Slides

PTGR1 CytoSection

Sign In for Pricing
View Details
IL-6 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-10807R-BF647 100 µL

IL-6 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
LASP1 (NM_006148) Human Over-expression Lysate
LS003927-100ug 100 µg

LASP1 (NM_006148) Human Over-expression Lysate

Sign In for Pricing
View Details
GK Antibody
orb685279 100 µL

GK Antibody

Sign In for Pricing
View Details