Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SCRG1 protein

This Human SCRG1 protein spans the amino acid sequence from region 21-98aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Scrapie-responsive gene 1 protein , ScRG-1

UniProt

O75711

Expression Region

21-98aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

12.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPANRLSCYRKILKDHNCHNLPEGVADLTQIDVNVQDHFWDGKGCEMICYCNFSELLCCPKDVFFGPKISFVIPCNNQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lbx1 (NM_010691) Mouse Recombinant Protein
E45M43084M5 20 µg

Lbx1 (NM_010691) Mouse Recombinant Protein

Sign In for Pricing
View Details
1-Chloro-3-fluorobenzene - 1ML
S-944 1 mL

1-Chloro-3-fluorobenzene - 1ML

Sign In for Pricing
View Details
Human Neurofascin (NFASC) ELISA Kit
abx152492-01 96 Tests

Human Neurofascin (NFASC) ELISA Kit

Sign In for Pricing
View Details
Human Neurofascin (NFASC) ELISA Kit
abx152492-02 5x 96 Tests

Human Neurofascin (NFASC) ELISA Kit

Sign In for Pricing
View Details
Human Neurofascin (NFASC) ELISA Kit
abx152492-03 10x 96 Tests

Human Neurofascin (NFASC) ELISA Kit

Sign In for Pricing
View Details
Anti-RBM41 Antibody Picoband®, APC Conjugate
A14311-1-APC 100 µg/Vial

Anti-RBM41 Antibody Picoband®, APC Conjugate

Sign In for Pricing
View Details