Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Fxn protein

This Mouse Fxn protein spans the amino acid sequence from region 78-207aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Fxn, FrdaFrataxin, mitochondrial, Fxn, EC 1.16.3.1) [Cleaved into, Frataxin intermediate form, Frataxin mature form]

UniProt

O35943

Expression Region

78-207aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LGTLDNPSSLDETAYERLAEETLDSLAEFFEDLADKPYTLEDYDVSFGDGVLTIKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLARELTKALNTKLDLSSLAYSGKGT

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Serpin A3/alpha 1-Antichymotrypsin Recombinant Protein Antigen
NBP1-90296PEP 0.1 mL

Serpin A3/alpha 1-Antichymotrypsin Recombinant Protein Antigen

Sign In for Pricing
View Details
NAB1 Mouse Monoclonal Antibody [Clone:4H3]
E45M15791 100 µg

NAB1 Mouse Monoclonal Antibody [Clone:4H3]

Sign In for Pricing
View Details
Rph3a-set siRNA/shRNA/RNAi Lentivector (Rat)
40725096 4x 500 ng

Rph3a-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
TrkA Recombinant Protein Antigen
NBP2-38265PEP 0.1 mL

TrkA Recombinant Protein Antigen

Sign In for Pricing
View Details
Thrombin heavy chain Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-1914R-BF555 100 µL

Thrombin heavy chain Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
Tofacitinib Impurity 65
RM-T060365-01 10 mg

Tofacitinib Impurity 65

Sign In for Pricing
View Details