Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Sort1 protein

This Rat Sort1 protein spans the amino acid sequence from region 610-754aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Glycoprotein 110 , Gp110Neurotensin receptor 3 , NTR3

UniProt

O54861

Expression Region

610-754aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CEENDYTTWLAHSTDPGDYKDGCILGYKEQFLRLRKSSVCQNGRDYVVAKQPSICPCSLEDFLCDFGYFRPENASECVEQPELKGHELEFCLYGKEEHLTTNGYRKIPGDRCQGGMNPAREVKDLKKKCTSNFLNPKKQNSKSSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CYB5R2 Adenovirus (Human)
17241051 1.0 mL

CYB5R2 Adenovirus (Human)

Sign In for Pricing
View Details
GRIA2 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
LV688416 1.0 µg DNA

GRIA2 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Pachymaran 50%
A6520 100 g

Pachymaran 50%

Sign In for Pricing
View Details
Nitric Oxide Synthase 3, Endothelial (NOS3) Recombinant, Porcine
156121-01 10 µg

Nitric Oxide Synthase 3, Endothelial (NOS3) Recombinant, Porcine

Sign In for Pricing
View Details
Nitric Oxide Synthase 3, Endothelial (NOS3) Recombinant, Porcine
156121-02 50 µg

Nitric Oxide Synthase 3, Endothelial (NOS3) Recombinant, Porcine

Sign In for Pricing
View Details
Nitric Oxide Synthase 3, Endothelial (NOS3) Recombinant, Porcine
156121-03 200 µg

Nitric Oxide Synthase 3, Endothelial (NOS3) Recombinant, Porcine

Sign In for Pricing
View Details