Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ADAMTS18 protein

This Human ADAMTS18 protein spans the amino acid sequence from region 942-1047aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ADAMTS21

UniProt

Q8TE60

Expression Region

942-1047aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TCSKACAGGQQSRKIQCVQKKPFQKEEAVLHSLCPVSTPTQVQACNSHACPPQWSLGPWSQCSKTCGRGVRKRELLCKGSAAETLPESQCTSLPRPELQEGCVLGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse TREM-1 (C-His)
BP130-50ug 50 µg

Recombinant Mouse TREM-1 (C-His)

Sign In for Pricing
View Details
Rat Myh4 Pre-designed siRNA Set A
SI208908A 1 Each

Rat Myh4 Pre-designed siRNA Set A

Sign In for Pricing
View Details
GLUT-1 (ABT-GLUT1) Antibody (Ready to Use)
V0078R-01 3 mL

GLUT-1 (ABT-GLUT1) Antibody (Ready to Use)

Sign In for Pricing
View Details
GLUT-1 (ABT-GLUT1) Antibody (Ready to Use)
V0078R-02 6 mL

GLUT-1 (ABT-GLUT1) Antibody (Ready to Use)

Sign In for Pricing
View Details
GLUT-1 (ABT-GLUT1) Antibody (Ready to Use)
V0078R-03 10 mL

GLUT-1 (ABT-GLUT1) Antibody (Ready to Use)

Sign In for Pricing
View Details
MANBA CRISPR All-in-one AAV vector set (with saCas9)(Human)
27991151 3x 1.0 µg DNA

MANBA CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details