Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ADAMTS18 protein

This Human ADAMTS18 protein spans the amino acid sequence from region 942-1047aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ADAMTS21

UniProt

Q8TE60

Expression Region

942-1047aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TCSKACAGGQQSRKIQCVQKKPFQKEEAVLHSLCPVSTPTQVQACNSHACPPQWSLGPWSQCSKTCGRGVRKRELLCKGSAAETLPESQCTSLPRPELQEGCVLGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MIP3B, CT (C-C Motif Chemokine 19, Small Inducible Cytokine A19, Macrophage Inflammatory Protein 3 beta, MIP-3-beta, Epstein-Barr Virus-induced Molecule 1 Ligand Chemokine, EBI1-ligand Chemokine, ELC, Beta Chemokine Exodus-3, CK beta-11, CCL19, SCYA19) (Azide free) (HRP) discontinued
M1202-65M-HRP 200 µL

MIP3B, CT (C-C Motif Chemokine 19, Small Inducible Cytokine A19, Macrophage Inflammatory Protein 3 beta, MIP-3-beta, Epstein-Barr Virus-induced Molecule 1 Ligand Chemokine, EBI1-ligand Chemokine, ELC, Beta Chemokine Exodus-3, CK beta-11, CCL19, SCYA19) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
C1qa (NM_001008515) Rat Tagged Lenti ORF Clone
RR205235L3 10 µg

C1qa (NM_001008515) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rabbit anti-human B-cell CLL/lymphoma 7 protein family member C polyclonal Antibody(BCL7C)
MBS1499769-01 0.05 mL

Rabbit anti-human B-cell CLL/lymphoma 7 protein family member C polyclonal Antibody(BCL7C)

Sign In for Pricing
View Details
Rabbit anti-human B-cell CLL/lymphoma 7 protein family member C polyclonal Antibody(BCL7C)
MBS1499769-02 0.1 mL

Rabbit anti-human B-cell CLL/lymphoma 7 protein family member C polyclonal Antibody(BCL7C)

Sign In for Pricing
View Details
Rabbit anti-human B-cell CLL/lymphoma 7 protein family member C polyclonal Antibody(BCL7C)
MBS1499769-03 5x 0.1 mL

Rabbit anti-human B-cell CLL/lymphoma 7 protein family member C polyclonal Antibody(BCL7C)

Sign In for Pricing
View Details
Olr1169 (NM_001000434) Rat Tagged ORF Clone
RR210334 10 µg

Olr1169 (NM_001000434) Rat Tagged ORF Clone

Sign In for Pricing
View Details