Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus UL128 protein

This Virus UL128 protein spans the amino acid sequence from region 1-171aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

UL128Uncharacterized protein UL128

UniProt

P16837

Expression Region

1-171aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Human cytomegalovirus (strain AD169) (HHV-5) (Human herpesvirus 5)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSPKDLTPFLTTLWLLLGHSRVPRVRAEECCEFINVNHPPERCYDFKMCNRFTVALRCPDGEVCYSPEKTAEIRGIVTTMTHSLTRQVVHNKLTSCNYNPLYLEADGRIRCGKVNDKAQYLLGAAGSVPYRWINLEYDKITRIVGLDQYLESVKKHKRLDVCRAKMGYMLQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

hsa-miR-302b-3p miRNA Mimic
MCH01673 2x 2.5 nmol

hsa-miR-302b-3p miRNA Mimic

Sign In for Pricing
View Details
SF2 polyclonal antibody
orb1725048-01 50 µL

SF2 polyclonal antibody

Sign In for Pricing
View Details
SF2 polyclonal antibody
orb1725048-02 100 µL

SF2 polyclonal antibody

Sign In for Pricing
View Details
GITRL (h) -PR
sc-39827-PR 10 µM - 20 µL

GITRL (h) -PR

Sign In for Pricing
View Details
Tissue Protein Lysate, Stomach
CP565658 150 µg

Tissue Protein Lysate, Stomach

Sign In for Pricing
View Details
NINJ1 siRNA Oligos set (Human)
31835171 3x 5 nmol

NINJ1 siRNA Oligos set (Human)

Sign In for Pricing
View Details