Plant PETE protein
This Plant PETE protein spans the amino acid sequence from region 70-168aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
PETE, Plastocyanin, chloroplastic
UniProt
P00289
Expression Region
70-168aa
Tag
N-terminal 6xHis-SUMO-tagged
Source
E.coli
Origin
Spinacia oleracea (Spinach)
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
26.4 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Partial
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
VEVLLGGGDGSLAFLPGDFSVASGEEIVFKNNAGFPHNVVFDEDEIPSGVDAAKISMSEEDLLNAPGETYKVTLTEKGTYKFYCSPHQGAGMVGKVTVN
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
E1050-05-HRP 100 µL
EBP50 (ERM (Ezrin-Radixin-Moesin) Binding Phosphoprotein of 50kD, Na (+) /H (+) Exchange Regulatory Cofactor NHE-RF1, NHERF, NHERF1, NHERF-1, NPHLOP2, Regulatory Cofactor of Na (+) /H (+) Exchanger, Sodium Hydrogen Exchanger Regulatory Factor 1, Solute Carrier Family 9 Isoform A3 Regulatory Factor 1, SLC9A3R1) (HRP) discontinued
Sign In for Pricing
View Details ![Rabbit Monoclonal Polyethylene Glycol Antibody (RM105) [Alexa Fluor 700]](https://cdn.genprice.uk/genprice/uk/genprice5.webp)
NBP3-26041AF700 0.1 mL
Rabbit Monoclonal Polyethylene Glycol Antibody (RM105) [Alexa Fluor 700]
Sign In for Pricing
View Details VAng-Cr5106-50gEcoli 50 µg (E. coli)
Recombinant Klebsiella Pneumoniae mrkB Protein (aa 19-233)
Sign In for Pricing
View Details 
19215141 1x 10^6 Cells / 1.0 mL
ELK4 CRISPR Knock Out 293T Cell Line (Human)
Sign In for Pricing
View Details