Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Plant PETE protein

This Plant PETE protein spans the amino acid sequence from region 70-168aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PETE, Plastocyanin, chloroplastic

UniProt

P00289

Expression Region

70-168aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Spinacia oleracea (Spinach)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VEVLLGGGDGSLAFLPGDFSVASGEEIVFKNNAGFPHNVVFDEDEIPSGVDAAKISMSEEDLLNAPGETYKVTLTEKGTYKFYCSPHQGAGMVGKVTVN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL21P104 ORF Vector (Human) (pORF)
40980011 1.0 µg DNA

RPL21P104 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
ICAT Rabbit mAb
E51A08465 100 µL

ICAT Rabbit mAb

Sign In for Pricing
View Details
LY 294002 Hydrochloride
454008-01 1 mg

LY 294002 Hydrochloride

Sign In for Pricing
View Details
LY 294002 Hydrochloride
454008-02 2.5 mg

LY 294002 Hydrochloride

Sign In for Pricing
View Details
FRMD7 Antibody
A58347-100UG 100 µg

FRMD7 Antibody

Sign In for Pricing
View Details
RNA-Binding Protein RO60 (RO60) Antibody
abx178400-01 100 µL

RNA-Binding Protein RO60 (RO60) Antibody

Sign In for Pricing
View Details