Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Ywhab protein

This Mouse Ywhab protein spans the amino acid sequence from region 1-246aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein kinase C inhibitor protein 1

UniProt

Q9CQV8

Expression Region

1-246aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLILNATQAESKVFYLKMKGDYFRYLSEVASGENKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Serine/threonine-protein phosphatase 2A activator
orb1637236-01 50 µg

Serine/threonine-protein phosphatase 2A activator

Sign In for Pricing
View Details
Serine/threonine-protein phosphatase 2A activator
orb1637236-02 100 µg

Serine/threonine-protein phosphatase 2A activator

Sign In for Pricing
View Details
Serine/threonine-protein phosphatase 2A activator
orb1637236-03 1 mg

Serine/threonine-protein phosphatase 2A activator

Sign In for Pricing
View Details
Mmu-miR-154-3p miRNA Mimic
orb1875782-01 5 nmol

Mmu-miR-154-3p miRNA Mimic

Sign In for Pricing
View Details
Mmu-miR-154-3p miRNA Mimic
orb1875782-02 10 nmol

Mmu-miR-154-3p miRNA Mimic

Sign In for Pricing
View Details
SERPINB6 Protein Vector (Human) (pPB-C-His)
PV037553 500 ng

SERPINB6 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details