E. coli mscL protein
This E. coli mscL protein spans the amino acid sequence from region 1-136aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
MscL, Z4661, ECs4156, Large-conductance mechanosensitive channel
UniProt
P0A743
Expression Region
1-136aa
Tag
N-terminal 6xHis-B2M-tagged
Source
E.coli
Origin
Escherichia coli O157:H7
Field of Research
Infectious Disease & Virology
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
29 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Full Length
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MSIIKEFREFAMRGNVVDLAVGVIIGAAFGKIVSSLVADIIMPPLGLLIGGIDFKQFAVTLRDAQGDIPAVVMHYGVFIQNVFDFLIVAFAIFMAIKLINKLNRKKEEPAAAPAPTKEEVLLTEIRDLLKEQNNRS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15111655 1 Vial
Lentiviral human NDUFAF8 shRNA (UAS) - Lentiviral human NDUFAF8 shRNA (UAS) plasmid
Sign In for Pricing
View Details MBS1391214-01 0.02 mg (E-Coli)
Recombinant Thermobifida fusca Tryptophan synthase alpha chain (trpA)
Sign In for Pricing
View Details MBS1391214-02 0.02 mg (Yeast)
Recombinant Thermobifida fusca Tryptophan synthase alpha chain (trpA)
Sign In for Pricing
View Details MBS1391214-03 0.1 mg (E-Coli)
Recombinant Thermobifida fusca Tryptophan synthase alpha chain (trpA)
Sign In for Pricing
View Details MBS1391214-04 0.1 mg (Yeast)
Recombinant Thermobifida fusca Tryptophan synthase alpha chain (trpA)
Sign In for Pricing
View Details MBS1391214-05 0.02 mg (Baculovirus)
Recombinant Thermobifida fusca Tryptophan synthase alpha chain (trpA)
Sign In for Pricing
View Details