Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli mscL protein

This E. coli mscL protein spans the amino acid sequence from region 1-136aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MscL, Z4661, ECs4156, Large-conductance mechanosensitive channel

UniProt

P0A743

Expression Region

1-136aa

Tag

N-terminal 6xHis-B2M-tagged

Source

E.coli

Origin

Escherichia coli O157:H7

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSIIKEFREFAMRGNVVDLAVGVIIGAAFGKIVSSLVADIIMPPLGLLIGGIDFKQFAVTLRDAQGDIPAVVMHYGVFIQNVFDFLIVAFAIFMAIKLINKLNRKKEEPAAAPAPTKEEVLLTEIRDLLKEQNNRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRH (Prothyroliberin, Thyroliberin, Protirelin, TSH-releasing Factor, TRF, Thyrotropin-releasing Hormone, Thyrotropin-releasing Factor) (PE)
134712-PE 100 µL

TRH (Prothyroliberin, Thyroliberin, Protirelin, TSH-releasing Factor, TRF, Thyrotropin-releasing Hormone, Thyrotropin-releasing Factor) (PE)

Sign In for Pricing
View Details
PIRC6 3'UTR GFP Stable Cell Line
TU068002 1.0 mL

PIRC6 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
MORN5 Antibody (C-term) Blocking peptide
MBS9218934-01 0.5 mg

MORN5 Antibody (C-term) Blocking peptide

Sign In for Pricing
View Details
MORN5 Antibody (C-term) Blocking peptide
MBS9218934-02 5x 0.5 mg

MORN5 Antibody (C-term) Blocking peptide

Sign In for Pricing
View Details
Arfaptin 1 (Arfaptin-1, ADP-Ribosylation Factor-interacting Protein 1, ARFIP1, Arfaptin1) discontinued
220834-01 50 µL

Arfaptin 1 (Arfaptin-1, ADP-Ribosylation Factor-interacting Protein 1, ARFIP1, Arfaptin1) discontinued

Sign In for Pricing
View Details
Arfaptin 1 (Arfaptin-1, ADP-Ribosylation Factor-interacting Protein 1, ARFIP1, Arfaptin1) discontinued
220834-02 100 µL

Arfaptin 1 (Arfaptin-1, ADP-Ribosylation Factor-interacting Protein 1, ARFIP1, Arfaptin1) discontinued

Sign In for Pricing
View Details