Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CTAG2 protein

This Human CTAG2 protein spans the amino acid sequence from region 1-210aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Autoimmunogenic cancer/testis antigen NY-ESO-2 Cancer/testis antigen 6.2 Short name, CT6.2 L antigen family member 1 Short name, LAGE-1 ESO2, LAGE1

UniProt

O75638

Expression Region

1-210aa

Tag

N-terminal 6xHis-sumostar-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

37.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MQAEGQGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPRGGAPRGPHGGAASAQDGRCPCGARRPDSRLLQLHITMPFSSPMEAELVRRILSRDAAPLPRPGAVLKDFTVSGNLLFMSVRDQDREGAGRMRVVGWGLGSASPEGQKARDLRTPKHKVSEQRPGTPGPPPPEGAQGDGCRGVAFNVMFSAPHI

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Angiotensinogen (AGT) Mouse Monoclonal Antibody [Clone ID: LBI10D2]
AMM16579V 100 µL

Angiotensinogen (AGT) Mouse Monoclonal Antibody [Clone ID: LBI10D2]

Sign In for Pricing
View Details
Ciao1 ORF Vector (Rat) (pORF)
ORF065014 1.0 µg DNA

Ciao1 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
IQCA Adenovirus (Mouse)
25043054 1.0 mL

IQCA Adenovirus (Mouse)

Sign In for Pricing
View Details
Olr749 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV637141 1.0 µg DNA

Olr749 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
CLP1 Rabbit Monoclonal Antibody
E49D1419 100 µL

CLP1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
PALM2AKAP2 Antibody
KC-37370-01 50 μL

PALM2AKAP2 Antibody

Sign In for Pricing
View Details