Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CTAG2 protein

This Human CTAG2 protein spans the amino acid sequence from region 1-210aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Autoimmunogenic cancer/testis antigen NY-ESO-2 Cancer/testis antigen 6.2 Short name, CT6.2 L antigen family member 1 Short name, LAGE-1 ESO2, LAGE1

UniProt

O75638

Expression Region

1-210aa

Tag

N-terminal 6xHis-sumostar-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

37.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MQAEGQGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPRGGAPRGPHGGAASAQDGRCPCGARRPDSRLLQLHITMPFSSPMEAELVRRILSRDAAPLPRPGAVLKDFTVSGNLLFMSVRDQDREGAGRMRVVGWGLGSASPEGQKARDLRTPKHKVSEQRPGTPGPPPPEGAQGDGCRGVAFNVMFSAPHI

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal OR6X1 Antibody [DyLight 680]
NBP3-26089FR 0.1 mL

Rabbit Polyclonal OR6X1 Antibody [DyLight 680]

Sign In for Pricing
View Details
Recombinant S Protein RBD (Mammalian, K458R, C-6His)
32-11479-50 50 µg

Recombinant S Protein RBD (Mammalian, K458R, C-6His)

Sign In for Pricing
View Details
Scn10a Antibody
42-841 0.1 mg

Scn10a Antibody

Sign In for Pricing
View Details
1- (2-Iodobenzyl) -1H-1,2,4-triazole
OR2053-01 250 mg

1- (2-Iodobenzyl) -1H-1,2,4-triazole

Sign In for Pricing
View Details
1- (2-Iodobenzyl) -1H-1,2,4-triazole
OR2053-02 1 g

1- (2-Iodobenzyl) -1H-1,2,4-triazole

Sign In for Pricing
View Details
Lentiviral human GPR15 shRNA (UAS) - Lentiviral human GPR15 shRNA (UAS, iRFP) (100)
GTR15338082 1 Vial

Lentiviral human GPR15 shRNA (UAS) - Lentiviral human GPR15 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details