What is the catalog number for Bovine Odorant-binding protein protein?

The catalog number for Bovine Odorant-binding protein protein is orb605463.

What sizes are available for Bovine Odorant-binding protein protein?

Bovine Odorant-binding protein protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Bovine Odorant-binding protein protein come in?

Bovine Odorant-binding protein protein is available in 3 different pack sizes.

Is Bovine Odorant-binding protein protein in stock?

Bovine Odorant-binding protein protein is currently made to order / not held in immediate stock. Contact us for lead time.

Bovine Odorant-binding protein protein

This Bovine Odorant-binding protein protein spans the amino acid sequence from region 1-159aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Olfactory mucosa pyrazine-binding protein

UniProt

P07435

Expression Region

1-159aa

Tag

N-terminal 6xHis-sumostar-tagged

Source

Yeast

Origin

Bos taurus (Bovine)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AQEEEAEQNLSELSGPWRTVYIGSTNPEKIQENGPFRTYFRELVFDDEKGTVDFYFSVKRDGKWKNVHVKATKQDDGTYVADYEGQNVFKIVSLSRTHLVAHNINVDKHGQTTELTELFVKLNVEDEDLEKFWKLTEDKGIDKKNVVNFLENEDHPHPE