Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine Odorant-binding protein protein

This Bovine Odorant-binding protein protein spans the amino acid sequence from region 1-159aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Olfactory mucosa pyrazine-binding protein

UniProt

P07435

Expression Region

1-159aa

Tag

Tag-Free

Source

Yeast

Origin

Bos taurus (Bovine)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AQEEEAEQNLSELSGPWRTVYIGSTNPEKIQENGPFRTYFRELVFDDEKGTVDFYFSVKRDGKWKNVHVKATKQDDGTYVADYEGQNVFKIVSLSRTHLVAHNINVDKHGQTTELTELFVKLNVEDEDLEKFWKLTEDKGIDKKNVVNFLENEDHPHPE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Colon
CS620505 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Mouse CD69 Antibody[H1.2F3]
E-AB-F1187UM1-01 25 µg

Elab Fluor® 700 Anti-Mouse CD69 Antibody[H1.2F3]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Mouse CD69 Antibody[H1.2F3]
E-AB-F1187UM1-02 100 µg

Elab Fluor® 700 Anti-Mouse CD69 Antibody[H1.2F3]

Sign In for Pricing
View Details
NKX3.1 (Metastatic Prostate Adenocarcinoma Marker) (NKX3.1/2576), 0.2mg/mL
BNUB2576-100 1x 100 µL

NKX3.1 (Metastatic Prostate Adenocarcinoma Marker) (NKX3.1/2576), 0.2mg/mL

Sign In for Pricing
View Details
AF4 Antibody
8C10690-AAT 50 µg

AF4 Antibody

Sign In for Pricing
View Details
FYCO1 Polyclonal Antibody
E-AB-19197-01 20 µL

FYCO1 Polyclonal Antibody

Sign In for Pricing
View Details