Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacteria icaB protein

This Bacteria icaB protein spans the amino acid sequence from region 29-290aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Biofilm polysaccharide intercellular adhesin deacetylase Short name, Biofilm PIA deacetylase Intercellular adhesion protein B

UniProt

Q7A349

Expression Region

29-290aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Staphylococcus aureus (strain N315)

Field of Research

Non-Animal

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NADDDSPKKLKYKENSALALNYHRVRKANFLNNFIYFFSSSKEIKNYSVSQSQFESQIKWLKSHDAKFLTLKEFLYYKKKGKFPKRSVWINFDDMDETIYENAYPILKKYKIPATGFIITGHVGEENFHNLDMISKKELKEMYKTGLWEFETHTHDLHNLSKNNKSKLMKASEATIIKDLNKSEKYLTKNFKKSQKTIAYPYGLMNDDKLPVIKKAGLKYGFSLEEKAVTPNSNDYYIPRILISDDAFEHLIKRWDGFHEKD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NDRG3 Rabbit Polyclonal Antibody (BF555)
orb2427817 100 µL

NDRG3 Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details
Chicken Arf GAP with coiled coil, ANK repeat and PH domain containing protein 1 (ACAP1) ELISA Kit
GTR10369641 96 Well

Chicken Arf GAP with coiled coil, ANK repeat and PH domain containing protein 1 (ACAP1) ELISA Kit

Sign In for Pricing
View Details
Mouse Anti-Rat Nav beta 3 Monoclonal IgG2B
MBS806989-01 0.1 mg

Mouse Anti-Rat Nav beta 3 Monoclonal IgG2B

Sign In for Pricing
View Details
Mouse Anti-Rat Nav beta 3 Monoclonal IgG2B
MBS806989-02 5x 0.1 mg

Mouse Anti-Rat Nav beta 3 Monoclonal IgG2B

Sign In for Pricing
View Details
Rabbit anti-PTEN Antibody
DL95290A-01 50 µL

Rabbit anti-PTEN Antibody

Sign In for Pricing
View Details
Rabbit anti-PTEN Antibody
DL95290A-02 100 µL

Rabbit anti-PTEN Antibody

Sign In for Pricing
View Details